SLC25A35 anticorps (N-Term)

N° du produit ABIN635087

Détail du produit anti-SLC25A35 anticorps

Antigène: SLC25A35 (Solute Carrier Family 25, Member 35 (SLC25A35))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A35 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC25 A35 antibody was raised against the N terminal of SLC25 35

Purification: Affinity purified

Immunogène: SLC25 A35 antibody was raised using the N terminal of SLC25 35 corresponding to a region with amino acids DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A35 Blocking Peptide, catalog no. 33R-1931, is also available for use as a blocking control in assays to test for specificity of this SLC25A35 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A35

Antigène: SLC25A35 (Solute Carrier Family 25, Member 35 (SLC25A35))

Autre désignation: SLC25A35 (SLC25A35 Produits)

Synonymes: anticorps si:ch211-268m12.5, anticorps 1810012H11Rik, anticorps solute carrier family 25, member 35, anticorps solute carrier family 25 member 35, anticorps slc25a35, anticorps SLC25A35, anticorps Slc25a35

Sujet: SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins.

Poids moléculaire: 31 kDa (MW of target protein)