NNT anticorps (N-Term)

N° du produit ABIN635092

Détail du produit anti-NNT anticorps

Antigène: NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NNT est non-conjugé

Application: Western Blotting (WB)

Specificité: NNT antibody was raised against the N terminal of NNT

Purification: Affinity purified

Immunogène: NNT antibody was raised using the N terminal of NNT corresponding to a region with amino acids IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NNT Blocking Peptide, catalog no. 33R-4206, is also available for use as a blocking control in assays to test for specificity of this NNT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NNT

Antigène: NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))

Autre désignation: NNT (NNT Produits)

Synonymes: anticorps Afu5g02780, anticorps GCCD4, anticorps 4930423F13Rik, anticorps AI323702, anticorps BB168308, anticorps wu:fa20d10, anticorps wu:fc86a04, anticorps zgc:76979, anticorps Nicotinamide Nucleotide Transhydrogenase, anticorps nicotinamide nucleotide transhydrogenase, anticorps nicotinamide nucleotide transhydrogenase L homeolog, anticorps nnt-1, anticorps AFUA_5G02780, anticorps nnt, anticorps NNT, anticorps Nnt, anticorps nnt.L

Sujet: NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification.

Poids moléculaire: 114 kDa (MW of target protein)

Pathways: Proton Transport