COQ2 anticorps

N° du produit ABIN635093

Détail du produit anti-COQ2 anticorps

Antigène: COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COQ2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COQ2 Blocking Peptide, catalog no. 33R-3061, is also available for use as a blocking control in assays to test for specificity of this COQ2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COQ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COQ2

Antigène: COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))

Autre désignation: COQ2 (COQ2 Produits)

Synonymes: anticorps CG9613, anticorps COQ2, anticorps Dmel\\CG9613, anticorps coq2, anticorps sbo, anticorps CL640, anticorps COQ10D1, anticorps MSA1, anticorps RGD1306722, anticorps zgc:162600, anticorps 2310002F18Rik, anticorps Coenzyme Q biosynthesis protein 2, anticorps coenzyme Q2, polyprenyltransferase, anticorps coenzyme Q2 4-hydroxybenzoate polyprenyltransferase, anticorps 4-hydroxybenzoate polyprenyltransferase, mitochondrial, anticorps Coq2, anticorps COQ2, anticorps coq2, anticorps coq-2

Sujet: COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.

Poids moléculaire: 42 kDa (MW of target protein)