MRS2 anticorps (Middle Region)

N° du produit ABIN635094

Détail du produit anti-MRS2 anticorps

Antigène: MRS2 (MRS2 Magnesium Homeostasis Factor Homolog (MRS2))

Épitope: Middle Region

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRS2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRS2 L antibody was raised against the middle region of Mrs2

Purification: Affinity purified

Immunogène: MRS2 L antibody was raised using the middle region of Mrs2 corresponding to a region with amino acids LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRS2L Blocking Peptide, catalog no. 33R-4838, is also available for use as a blocking control in assays to test for specificity of this MRS2L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRS2

Antigène: MRS2 (MRS2 Magnesium Homeostasis Factor Homolog (MRS2))

Autre désignation: MRS2L (MRS2 Produits)

Synonymes: anticorps Gm902, anticorps HPT, anticorps Mrs2l, anticorps RPT, anticorps Rpt, anticorps MRS2L, anticorps MRS2 magnesium transporter, anticorps MRS2, magnesium transporter, anticorps Mrs2, anticorps MRS2

Sujet: MRS2L is a magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix.

Poids moléculaire: 50 kDa (MW of target protein)