SFXN1 anticorps (N-Term)

N° du produit ABIN635095

Détail du produit anti-SFXN1 anticorps

Antigène: SFXN1 (Sideroflexin 1 (SFXN1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFXN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Sideroflexin 1 antibody was raised against the N terminal of SFXN1

Purification: Affinity purified

Immunogène: Sideroflexin 1 antibody was raised using the N terminal of SFXN1 corresponding to a region with amino acids MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Sideroflexin 1 Blocking Peptide, catalog no. 33R-6424, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFXN1

Antigène: SFXN1 (Sideroflexin 1 (SFXN1))

Autre désignation: Sideroflexin 1 (SFXN1 Produits)

Synonymes: anticorps zgc:100851, anticorps 2810002O05Rik, anticorps A930015P12Rik, anticorps f, anticorps Sideroflexin 1, anticorps sideroflexin 1, anticorps sideroflexin 1 L homeolog, anticorps Bm1_35025, anticorps sfxn1, anticorps sfxn1.L, anticorps SFXN1, anticorps Sfxn1

Sujet: SFXN1 might be involved in the transport of a component required for iron utilization into or out of the mitochondria.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis