MFRP anticorps (N-Term)

N° du produit ABIN635098

Détail du produit anti-MFRP anticorps

Antigène: MFRP (Membrane Frizzled-Related Protein (MFRP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MFRP est non-conjugé

Application: Western Blotting (WB)

Specificité: MFRP antibody was raised against the N terminal of MFRP

Purification: Affinity purified

Immunogène: MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MFRP Blocking Peptide, catalog no. 33R-8996, is also available for use as a blocking control in assays to test for specificity of this MFRP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFRP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MFRP

Antigène: MFRP (Membrane Frizzled-Related Protein (MFRP))

Autre désignation: MFRP (MFRP Produits)

Synonymes: anticorps MFRP, anticorps MCOP5, anticorps NNO2, anticorps RD6, anticorps rd6, anticorps C1q and TNF related 5, anticorps membrane frizzled-related protein, anticorps C1QTNF5, anticorps MFRP, anticorps Mfrp

Sujet: MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen.

Poids moléculaire: 62 kDa (MW of target protein)