MFRP anticorps (N-Term)
-
- Antigène Voir toutes MFRP Anticorps
- MFRP (Membrane Frizzled-Related Protein (MFRP))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MFRP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MFRP antibody was raised against the N terminal of MFRP
- Purification
- Affinity purified
- Immunogène
- MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE
- Top Product
- Discover our top product MFRP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MFRP Blocking Peptide, catalog no. 33R-8996, is also available for use as a blocking control in assays to test for specificity of this MFRP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFRP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MFRP (Membrane Frizzled-Related Protein (MFRP))
- Autre désignation
- MFRP (MFRP Produits)
- Sujet
- MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen.
- Poids moléculaire
- 62 kDa (MW of target protein)
-