TRPM2 anticorps (N-Term)
-
- Antigène Voir toutes TRPM2 Anticorps
- TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRPM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRPM2 antibody was raised against the N terminal of TRPM2
- Purification
- Affinity purified
- Immunogène
- TRPM2 antibody was raised using the N terminal of TRPM2 corresponding to a region with amino acids VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
- Top Product
- Discover our top product TRPM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRPM2 Blocking Peptide, catalog no. 33R-9418, is also available for use as a blocking control in assays to test for specificity of this TRPM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))
- Autre désignation
- TRPM2 (TRPM2 Produits)
- Synonymes
- anticorps EREG1, anticorps KNP3, anticorps LTRPC2, anticorps NUDT9H, anticorps NUDT9L1, anticorps TRPC7, anticorps Trpm2-predicted, anticorps TRPM2, anticorps si:ch73-263b18.1, anticorps 9830168K16Rik, anticorps C79133, anticorps Trp7, anticorps Trrp7, anticorps transient receptor potential cation channel subfamily M member 2, anticorps transient receptor potential cation channel, subfamily M, member 2, anticorps transient receptor potential cation channel subfamily C member 7, anticorps TRPM2, anticorps Trpm2, anticorps trpm2, anticorps TRPC7
- Sujet
- The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
- Poids moléculaire
- 171 kDa (MW of target protein)
-