ANO3 anticorps (C-Term)

N° du produit ABIN635122

Détail du produit anti-ANO3 anticorps

Antigène: ANO3 (Anoctamin 3 (ANO3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANO3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM16 C antibody was raised against the C terminal of TMEM16

Purification: Affinity purified

Immunogène: TMEM16 C antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM16C Blocking Peptide, catalog no. 33R-1181, is also available for use as a blocking control in assays to test for specificity of this TMEM16C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANO3

Antigène: ANO3 (Anoctamin 3 (ANO3))

Autre désignation: TMEM16C (ANO3 Produits)

Synonymes: anticorps TMEM16C, anticorps anoctamin-3, anticorps C11orf25, anticorps DYT23, anticorps DYT24, anticorps AI838058, anticorps B230324K02Rik, anticorps Tmem16c, anticorps anoctamin 3, anticorps anoctamin-3, anticorps ANO3, anticorps LOC100453980, anticorps ano3, anticorps Ano3

Sujet: TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.

Poids moléculaire: 115 kDa (MW of target protein)