GDAP1L1 anticorps (N-Term)

N° du produit ABIN635125

Détail du produit anti-GDAP1L1 anticorps

Antigène: GDAP1L1 (Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 (GDAP1L1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GDAP1L1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GDAP1 L1 antibody was raised against the N terminal of GDAP1 1

Purification: Affinity purified

Immunogène: GDAP1 L1 antibody was raised using the N terminal of GDAP1 1 corresponding to a region with amino acids ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GDAP1L1 Blocking Peptide, catalog no. 33R-2689, is also available for use as a blocking control in assays to test for specificity of this GDAP1L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GDAP1L1

Antigène: GDAP1L1 (Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 (GDAP1L1))

Autre désignation: GDAP1L1 (GDAP1L1 Produits)

Synonymes: anticorps GDAP1L1, anticorps MGC146673, anticorps dJ881L22.1, anticorps dJ995J12.1.1, anticorps Gdap1l, anticorps ganglioside induced differentiation associated protein 1 like 1, anticorps ganglioside induced differentiation associated protein 1-like 1, anticorps ganglioside-induced differentiation-associated protein 1-like 1, anticorps GDAP1L1, anticorps gdap1l1, anticorps Gdap1l1

Sujet: The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. GDAP1L1 is similar in sequence to the human GDAP1 protein.

Poids moléculaire: 42 kDa (MW of target protein)