SLCO1C1 anticorps (N-Term)
-
- Antigène Voir toutes SLCO1C1 Anticorps
- SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLCO1C1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLCO1 C1 antibody was raised against the N terminal of SLCO1 1
- Purification
- Affinity purified
- Immunogène
- SLCO1 C1 antibody was raised using the N terminal of SLCO1 1 corresponding to a region with amino acids VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ
- Top Product
- Discover our top product SLCO1C1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLCO1C1 Blocking Peptide, catalog no. 33R-9482, is also available for use as a blocking control in assays to test for specificity of this SLCO1C1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Fluorescent Detection of Vestibular Schwannoma Using Intravenous Sodium Fluorescein In Vivo." dans: Otology & neurotology : official publication of the American Otological Society, American Neurotology Society [and] European Academy of Otology and Neurotology, Vol. 42, Issue 4, pp. e503-e511, (2021) (PubMed).
: "
-
Fluorescent Detection of Vestibular Schwannoma Using Intravenous Sodium Fluorescein In Vivo." dans: Otology & neurotology : official publication of the American Otological Society, American Neurotology Society [and] European Academy of Otology and Neurotology, Vol. 42, Issue 4, pp. e503-e511, (2021) (PubMed).
-
- Antigène
- SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))
- Autre désignation
- SLCO1C1 (SLCO1C1 Produits)
- Synonymes
- anticorps OATP-F, anticorps OATP1, anticorps OATP14, anticorps OATP1C1, anticorps OATPF, anticorps OATPRP5, anticorps SLC21A14, anticorps OATP-14, anticorps Oatp2, anticorps Oatpf, anticorps Slc21a14, anticorps Bsat1, anticorps Oatp14, anticorps solute carrier organic anion transporter family member 1C1, anticorps solute carrier organic anion transporter family, member 1c1, anticorps SLCO1C1, anticorps Slco1c1
- Sujet
- SLCO1C1 is a member of the organic anion transporter family. SLCO1C1 is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyroid hormones thyroxine, tri-iodothyronine and reverse tri-iodothyronine. Polymorphisms in the gene encoding this protein may be associated with fatigue and depression in patients suffering from hyperthyroidism.
- Poids moléculaire
- 79 kDa (MW of target protein)
-