BACE2 anticorps (Middle Region)

N° du produit ABIN635132

Détail du produit anti-BACE2 anticorps

Antigène: BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BACE2 est non-conjugé

Application: Western Blotting (WB)

Specificité: BACE2 antibody was raised against the middle region of BACE2

Purification: Affinity purified

Immunogène: BACE2 antibody was raised using the middle region of BACE2 corresponding to a region with amino acids SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BACE2 Blocking Peptide, catalog no. 33R-8612, is also available for use as a blocking control in assays to test for specificity of this BACE2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BACE2

Antigène: BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))

Autre désignation: BACE2 (BACE2 Produits)

Synonymes: anticorps AEPLC, anticorps ALP56, anticorps ASP1, anticorps ASP21, anticorps BAE2, anticorps CEAP1, anticorps DRAP, anticorps 1110059C24Rik, anticorps AI850424, anticorps ARP1, anticorps CDA13, anticorps beta-site APP-cleaving enzyme 2, anticorps BACE2, anticorps Bace2

Sujet: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

Poids moléculaire: 37 kDa (MW of target protein)