GPR177/WLS anticorps (N-Term)

N° du produit ABIN635133

Détail du produit anti-GPR177/WLS anticorps

Antigène: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Épitope: N-Term

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPR177/WLS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: GPR177 antibody was raised against the N terminal of GPR177

Purification: Affinity purified

Immunogène: GPR177 antibody was raised using the N terminal of GPR177 corresponding to a region with amino acids ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPR177 Blocking Peptide, catalog no. 33R-1477, is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR177 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPR177/WLS

Antigène: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Autre désignation: GPR177 (WLS Produits)

Synonymes: anticorps C1orf139, anticorps EVI, anticorps GPR177, anticorps MRP, anticorps mig-14, anticorps 5031439A09Rik, anticorps AI173978, anticorps AI987742, anticorps Gpr177, anticorps gpr117, anticorps gpr177, anticorps sb:cb610, anticorps wu:fb36d04, anticorps wu:fb44d10, anticorps wu:fb50c06, anticorps zgc:64091, anticorps CG6210, anticorps Dmel\\CG6210, anticorps Evi, anticorps Evi/Wls, anticorps Srt, anticorps Wls, anticorps Wls/Evi, anticorps evi, anticorps srt, anticorps wls/evi, anticorps wntless Wnt ligand secretion mediator, anticorps wntless homolog (Drosophila), anticorps wntless, anticorps WLS, anticorps Wls, anticorps wls

Sujet: GPR177 is a receptor for Wnt proteins in Wnt-secreting cells.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Signalisation WNT