Anoctamin 6 anticorps (Middle Region)
-
- Antigène Voir toutes Anoctamin 6 (ANO6) Anticorps
- Anoctamin 6 (ANO6)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Anoctamin 6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Anoctamin 6 antibody was raised against the middle region of ANO6
- Purification
- Affinity purified
- Immunogène
- Anoctamin 6 antibody was raised using the middle region of ANO6 corresponding to a region with amino acids KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
- Top Product
- Discover our top product ANO6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Anoctamin 6 Blocking Peptide, catalog no. 33R-4651, is also available for use as a blocking control in assays to test for specificity of this Anoctamin 6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANO6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Anoctamin 6 (ANO6)
- Autre désignation
- Anoctamin 6 (ANO6 Produits)
- Synonymes
- anticorps TMEM16F, anticorps 2900059G15Rik, anticorps AA407480, anticorps AW554778, anticorps F730003B03Rik, anticorps Tmem16f, anticorps BDPLT7, anticorps SCTS, anticorps anoctamin 6, anticorps ANO6, anticorps ano6, anticorps Ano6
- Sujet
- TMEM16F may act as a calcium-activated chloride channel.
- Poids moléculaire
- 106 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-