SLCO1A2 anticorps (Middle Region)

N° du produit ABIN635140

Détail du produit anti-SLCO1A2 anticorps

Antigène: SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLCO1A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLCO1 A2 antibody was raised against the middle region of SLCO1 2

Purification: Affinity purified

Immunogène: SLCO1 A2 antibody was raised using the middle region of SLCO1 2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLCO1A2 Blocking Peptide, catalog no. 33R-1268, is also available for use as a blocking control in assays to test for specificity of this SLCO1A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLCO1A2

Antigène: SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))

Autre désignation: SLCO1A2 (SLCO1A2 Produits)

Synonymes: anticorps OATP, anticorps OATP-A, anticorps OATP1A2, anticorps SLC21A3, anticorps Oatp2, anticorps Slc21a5, anticorps Slco1a4, anticorps solute carrier organic anion transporter family member 1A2, anticorps solute carrier organic anion transporter family, member 1A2, anticorps SLCO1A2, anticorps Slco1a2

Sujet: SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.

Poids moléculaire: 64 kDa (MW of target protein)