Synaptophysin anticorps (N-Term)
-
- Antigène Voir toutes Synaptophysin (SYP) Anticorps
- Synaptophysin (SYP)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Synaptophysin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Synaptophysin antibody was raised against the N terminal of SYP
- Purification
- Affinity purified
- Immunogène
- Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
- Top Product
- Discover our top product SYP Anticorps primaire
-
anti-Synaptophysin (SYP) (AA 225-253), (C-Term) antibody
SYP Reactivité: Humain, Souris WB, IF, IHC (p), FACS Hôte: Lapin Polyclonal RB32966 unconjugated
anti-Synaptophysin (SYP) (C-Term) antibodySYP Reactivité: Humain WB, IF, IHC (p), ICC, IHC (fro), IHC (wm) Hôte: Lapin Polyclonal unconjugated
anti-Synaptophysin (SYP) (AA 150-250) antibodySYP Reactivité: Humain WB, IHC, IF, IP Hôte: Lapin Polyclonal unconjugated
anti-Synaptophysin (SYP) (AA 225-253), (C-Term) antibodySYP Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB32966 unconjugated
anti-Synaptophysin (SYP) (Internal Region) antibodySYP Reactivité: Humain, Souris, Rat WB, IHC, IF, ELISA, ICC Hôte: Lapin Polyclonal unconjugated
anti-Synaptophysin (SYP) antibodySYP Reactivité: Humain, Chien WB, IF Hôte: Souris Monoclonal 5H2 unconjugated
anti-Synaptophysin (SYP) (AA 205-306) antibodySYP Reactivité: Humain, Souris, Rat WB, IF, BI Hôte: Souris Monoclonal 2-Synaptophysin unconjugated
anti-Synaptophysin (SYP) (N-Term) antibodySYP Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Poisson zèbre (Danio rerio), Chévre WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Synaptophysin (SYP) antibodySYP Reactivité: Humain, Rat WB, IHC, ELISA Hôte: Souris Monoclonal 7H12 unconjugated
anti-Synaptophysin (SYP) antibodyMicroarray verified SYP Reactivité: Humain, Souris IHC Hôte: Souris Monoclonal MAB551901 unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Synaptophysin Blocking Peptide, catalog no. 33R-6191, is also available for use as a blocking control in assays to test for specificity of this Synaptophysin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Synaptophysin (SYP)
- Autre désignation
- Synaptophysin (SYP Produits)
- Synonymes
- anticorps syp-B, anticorps xsypii, anticorps MGC86267, anticorps MRXSYP, anticorps A230093K24Rik, anticorps AI848995, anticorps Syn, anticorps p38, anticorps Syp1, anticorps mrxsyp, anticorps syp, anticorps xsypi, anticorps synaptophysin S homeolog, anticorps synaptophysin, anticorps synaptophysin L homeolog, anticorps synaptophysin a, anticorps syp.S, anticorps SYP, anticorps syp, anticorps Syp, anticorps syp.L, anticorps sypa
- Sujet
- Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of long-term Neuronal Synaptic Plasticity
-
