Anoctamin 10 anticorps (C-Term)

N° du produit ABIN635146

Détail du produit anti-Anoctamin 10 anticorps

Antigène: Anoctamin 10 (ANO10)

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Anoctamin 10 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM16 K antibody was raised against the C terminal of TMEM16

Purification: Affinity purified

Immunogène: TMEM16 K antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM16K Blocking Peptide, catalog no. 33R-5070, is also available for use as a blocking control in assays to test for specificity of this TMEM16K antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Anoctamin 10

Antigène: Anoctamin 10 (ANO10)

Autre désignation: TMEM16K (ANO10 Produits)

Synonymes: anticorps TMEM16K, anticorps ano10, anticorps zgc:114140, anticorps tmem16k, anticorps SCAR10, anticorps AI604832, anticorps Tmem16k, anticorps RGD1308260, anticorps anoctamin 10, anticorps anoctamin 10a, anticorps transmembrane protein 16K, anticorps anoctamin 10 L homeolog, anticorps ANO10, anticorps ano10, anticorps ano10a, anticorps MCYG_02694, anticorps MGYG_08424, anticorps ano10.L, anticorps Ano10

Sujet: TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.

Poids moléculaire: 76 kDa (MW of target protein)