TMEM206 anticorps (N-Term)

N° du produit ABIN635147

Détail du produit anti-TMEM206 anticorps

Antigène: TMEM206 (C1orf75) (Transmembrane Protein 206 (C1orf75))

Épitope: N-Term

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM206 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF75 antibody was raised against the N terminal Of C1 rf75

Purification: Affinity purified

Immunogène: C1 ORF75 antibody was raised using the N terminal Of C1 rf75 corresponding to a region with amino acids IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF75 Blocking Peptide, catalog no. 33R-3958, is also available for use as a blocking control in assays to test for specificity of this C1ORF75 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM206

Antigène: TMEM206 (C1orf75) (Transmembrane Protein 206 (C1orf75))

Autre désignation: C1ORF75 (C1orf75 Produits)

Synonymes: anticorps C1orf75, anticorps RP11-384C4.5, anticorps 2310028N02Rik, anticorps AI118576, anticorps RGD1359339, anticorps C16H1orf75, anticorps transmembrane protein 206, anticorps transmembrane protein 206 L homeolog, anticorps TMEM206, anticorps Tmem206, anticorps tmem206.L

Sujet: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 40 kDa (MW of target protein)