TMEM144 anticorps (Middle Region)

N° du produit ABIN635148

Détail du produit anti-TMEM144 anticorps

Antigène: TMEM144 (Transmembrane Protein 144 (TMEM144))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM144 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM144 antibody was raised against the middle region of TMEM144

Purification: Affinity purified

Immunogène: TMEM144 antibody was raised using the middle region of TMEM144 corresponding to a region with amino acids LSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM144 Blocking Peptide, catalog no. 33R-5463, is also available for use as a blocking control in assays to test for specificity of this TMEM144 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM144 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM144

Antigène: TMEM144 (Transmembrane Protein 144 (TMEM144))

Autre désignation: TMEM144 (TMEM144 Produits)

Synonymes: anticorps tmem144, anticorps zgc:100814, anticorps 1110057I03Rik, anticorps 5730537D05Rik, anticorps RGD1565845, anticorps transmembrane protein 144, anticorps transmembrane protein 144a, anticorps transmembrane protein 144 L homeolog, anticorps TMEM144, anticorps tmem144a, anticorps tmem144, anticorps tmem144.L, anticorps Tmem144

Sujet: The function of the TMEM144 protein remains unknown.

Poids moléculaire: 38 kDa (MW of target protein)