CISD2 anticorps (N-Term)

N° du produit ABIN635156

Détail du produit anti-CISD2 anticorps

Antigène: CISD2 (CDGSH Iron Sulfur Domain 2 (CISD2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CISD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CISD2 antibody was raised against the N terminal of CISD2

Purification: Affinity purified

Immunogène: CISD2 antibody was raised using the N terminal of CISD2 corresponding to a region with amino acids VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CISD2 Blocking Peptide, catalog no. 33R-9652, is also available for use as a blocking control in assays to test for specificity of this CISD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CISD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CISD2

Antigène: CISD2 (CDGSH Iron Sulfur Domain 2 (CISD2))

Autre désignation: CISD2 (CISD2 Produits)

Synonymes: anticorps ERIS, anticorps Miner1, anticorps NAF-1, anticorps WFS2, anticorps ZCD2, anticorps 1500009M05Rik, anticorps 1500026J14Rik, anticorps 1500031D15Rik, anticorps AI848398, anticorps B630006A20Rik, anticorps Noxp70, anticorps Zcd2, anticorps RGD1566242, anticorps zgc:64148, anticorps eris, anticorps miner1, anticorps wfs2, anticorps zcd2, anticorps cisd2, anticorps BcDNA:RE49709, anticorps Dmel\\CG1458, anticorps CDGSH iron sulfur domain 2, anticorps CDGSH iron sulfur domain 2 L homeolog, anticorps CDGSH iron sulfur domain 2 S homeolog, anticorps CISD2, anticorps Cisd2, anticorps cisd2, anticorps cisd2.L, anticorps cisd2.S

Sujet: CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Activation of Innate immune Response