PORCN anticorps

N° du produit ABIN635157

Détail du produit anti-PORCN anticorps

Antigène: PORCN (Porcupine Homolog (PORCN))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PORCN est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PORCN antibody was raised using a synthetic peptide corresponding to a region with amino acids ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PORCN Blocking Peptide, catalog no. 33R-1079, is also available for use as a blocking control in assays to test for specificity of this PORCN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PORCN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PORCN

Antigène: PORCN (Porcupine Homolog (PORCN))

Autre désignation: PORCN (PORCN Produits)

Synonymes: anticorps 15175, anticorps CG6205, anticorps Dmel\\CG6205, anticorps Porc, anticorps dmPorc, anticorps l(1)17Ac, anticorps poc, anticorps porc, anticorps DHOF, anticorps FODH, anticorps MG61, anticorps PORC, anticorps PPN, anticorps porcupine, anticorps 2410004O13Rik, anticorps AW045557, anticorps DXHXS7465e, anticorps Mporc, anticorps Mporc-a, anticorps Mporc-b, anticorps Mporc-c, anticorps Mporc-d, anticorps Ppn, anticorps mMg61, anticorps RGD1564947, anticorps porcupine, anticorps porcupine O-acyltransferase, anticorps porcupine homolog (Drosophila), anticorps por, anticorps PORCN, anticorps Porcn

Sujet: PORCN belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Poids moléculaire: 51 kDa (MW of target protein)