UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 18 (GALNT18) (Middle Region) anticorps

N° du produit ABIN635162

Détail du produit

Antigène: UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 18 (GALNT18)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: GALNTL4 antibody was raised against the middle region of GALNTL4

Purification: Affinity purified

Immunogène: GALNTL4 antibody was raised using the middle region of GALNTL4 corresponding to a region with amino acids IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALNTL4 Blocking Peptide, catalog no. 33R-3993, is also available for use as a blocking control in assays to test for specificity of this GALNTL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNTL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 18 (GALNT18)

Autre désignation: GALNTL4 (GALNT18 Produits)

Synonymes: anticorps GALNACT18, anticorps GALNT15, anticorps GALNTL4, anticorps GalNAc-T15, anticorps GalNAc-T18, anticorps 2900011G21Rik, anticorps BC024988, anticorps Galntl4, anticorps RGD1309623, anticorps galntl4a, anticorps zgc:194153, anticorps polypeptide N-acetylgalactosaminyltransferase 18, anticorps UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 18a, anticorps GALNT18, anticorps Galnt18, anticorps galnt18a

Sujet: GALNTL4 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

Poids moléculaire: 69 kDa (MW of target protein)