SLC37A3 anticorps

N° du produit ABIN635164

Détail du produit anti-SLC37A3 anticorps

Antigène: SLC37A3 (Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC37A3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: SLC37 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC37A3 Blocking Peptide, catalog no. 33R-2888, is also available for use as a blocking control in assays to test for specificity of this SLC37A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC37A3

Antigène: SLC37A3 (Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3))

Autre désignation: SLC37A3 (SLC37A3 Produits)

Synonymes: anticorps 2610507O21Rik, anticorps AU044904, anticorps solute carrier family 37 member 3, anticorps solute carrier family 37 (glycerol-3-phosphate transporter), member 3, anticorps solute carrier family 37, member 3, anticorps SLC37A3, anticorps Slc37a3

Sujet: SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.

Poids moléculaire: 54 kDa (MW of target protein)