INSIG1 anticorps (Middle Region)

N° du produit ABIN635167

Détail du produit anti-INSIG1 anticorps

Antigène: INSIG1 (Insulin Induced Gene 1 (INSIG1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp INSIG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: INSIG1 antibody was raised against the middle region of INSIG1

Purification: Affinity purified

Immunogène: INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

INSIG1 Blocking Peptide, catalog no. 33R-10042, is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur INSIG1

Antigène: INSIG1 (Insulin Induced Gene 1 (INSIG1))

Autre désignation: INSIG1 (INSIG1 Produits)

Synonymes: anticorps cl-6, anticorps cl6, anticorps CL-6, anticorps CL6, anticorps fb55a03, anticorps fi35b10, anticorps wu:fb55a03, anticorps wu:fi35b10, anticorps zgc:55439, anticorps 1810013C12Rik, anticorps Insig-1, anticorps INSIG-1, anticorps insulin induced gene 1, anticorps insulin induced gene 1 L homeolog, anticorps INSIG1, anticorps insig1, anticorps insig1.L, anticorps Insig1

Sujet: Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling