SLC3A1 anticorps (N-Term)
-
- Antigène Voir toutes SLC3A1 Anticorps
- SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC3A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC3 A1 antibody was raised against the N terminal of SLC3 1
- Purification
- Affinity purified
- Immunogène
- SLC3 A1 antibody was raised using the N terminal of SLC3 1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT
- Top Product
- Discover our top product SLC3A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC3A1 Blocking Peptide, catalog no. 33R-1937, is also available for use as a blocking control in assays to test for specificity of this SLC3A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))
- Autre désignation
- SLC3A1 (SLC3A1 Produits)
- Synonymes
- anticorps D2H, anticorps NBAT, anticorps NTAA, anticorps RBAT, anticorps SLC3A1, anticorps MGC131051, anticorps ATR1, anticorps CSNU1, anticorps solute carrier family 3, member 1, anticorps solute carrier family 3 member 1, anticorps solute carrier family 3 (amino acid transporter heavy chain), member 1 L homeolog, anticorps solute carrier family 3 (amino acid transporter heavy chain), member 1, anticorps Slc3a1, anticorps SLC3A1, anticorps slc3a1.L, anticorps slc3a1
- Sujet
- This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract.
- Poids moléculaire
- 79 kDa (MW of target protein)
-