SLC3A1 anticorps (N-Term)

N° du produit ABIN635179

Détail du produit anti-SLC3A1 anticorps

Antigène: SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC3A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC3 A1 antibody was raised against the N terminal of SLC3 1

Purification: Affinity purified

Immunogène: SLC3 A1 antibody was raised using the N terminal of SLC3 1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC3A1 Blocking Peptide, catalog no. 33R-1937, is also available for use as a blocking control in assays to test for specificity of this SLC3A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC3A1

Antigène: SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))

Autre désignation: SLC3A1 (SLC3A1 Produits)

Synonymes: anticorps D2H, anticorps NBAT, anticorps NTAA, anticorps RBAT, anticorps SLC3A1, anticorps MGC131051, anticorps ATR1, anticorps CSNU1, anticorps solute carrier family 3, member 1, anticorps solute carrier family 3 member 1, anticorps solute carrier family 3 (amino acid transporter heavy chain), member 1 L homeolog, anticorps solute carrier family 3 (amino acid transporter heavy chain), member 1, anticorps Slc3a1, anticorps SLC3A1, anticorps slc3a1.L, anticorps slc3a1

Sujet: This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract.

Poids moléculaire: 79 kDa (MW of target protein)