PEX11A anticorps (Middle Region)
-
- Antigène Voir toutes PEX11A Anticorps
- PEX11A (Peroxisomal Biogenesis Factor 11 alpha (PEX11A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PEX11A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PEX11 A antibody was raised against the middle region of PEX11
- Purification
- Affinity purified
- Immunogène
- PEX11 A antibody was raised using the middle region of PEX11 corresponding to a region with amino acids MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL
- Top Product
- Discover our top product PEX11A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PEX11A Blocking Peptide, catalog no. 33R-6165, is also available for use as a blocking control in assays to test for specificity of this PEX11A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PEX11A (Peroxisomal Biogenesis Factor 11 alpha (PEX11A))
- Autre désignation
- PEX11A (PEX11A Produits)
- Synonymes
- anticorps PEX11-ALPHA, anticorps PMP28, anticorps hsPEX11p, anticorps PEX11alpha, anticorps Pmp26p, anticorps T2E6.18, anticorps T2E6_18, anticorps peroxin 11A, anticorps peroxisomal biogenesis factor 11 alpha, anticorps peroxin 11A, anticorps PEX11A, anticorps Pex11a
- Sujet
- PEX11A belongs to the peroxin-11 family. It may be involved in peroxisomal proliferation and may regulate peroxisomes division. PEX11A may mediate binding of coatomer proteins to the peroxisomal membrane.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha, Brown Fat Cell Differentiation
-