STRA6 anticorps
-
- Antigène Voir toutes STRA6 Anticorps
- STRA6 (Stimulated By Retinoic Acid 6 (STRA6))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STRA6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- STRA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG
- Top Product
- Discover our top product STRA6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STRA6 Blocking Peptide, catalog no. 33R-6506, is also available for use as a blocking control in assays to test for specificity of this STRA6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRA6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STRA6 (Stimulated By Retinoic Acid 6 (STRA6))
- Autre désignation
- STRA6 (STRA6 Produits)
- Synonymes
- anticorps MCOPCB8, anticorps MCOPS9, anticorps AI891933, anticorps RGD1307551, anticorps STRA6, anticorps im:7151282, anticorps wu:fc51h06, anticorps zgc:136689, anticorps mcops9, anticorps pp14296, anticorps stimulated by retinoic acid 6, anticorps stimulated by retinoic acid gene 6, anticorps stimulated by retinoic acid gene 6 homolog (mouse), anticorps STRA6, anticorps Stra6, anticorps stra6
- Sujet
- STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex.
- Poids moléculaire
- 73 kDa (MW of target protein)
- Pathways
- Feeding Behaviour
-