Calsyntenin 3 anticorps (N-Term)

N° du produit ABIN635191

Détail du produit anti-Calsyntenin 3 anticorps

Antigène: Calsyntenin 3 (CLSTN3)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Calsyntenin 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: Calsyntenin 3 antibody was raised against the N terminal of CLSTN3

Purification: Affinity purified

Immunogène: Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calsyntenin 3 Blocking Peptide, catalog no. 33R-7585, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Calsyntenin 3

Antigène: Calsyntenin 3 (CLSTN3)

Autre désignation: Calsyntenin 3 (CLSTN3 Produits)

Synonymes: anticorps cstn3, anticorps cdhr14, anticorps alcbeta, anticorps MGC84020, anticorps CDHR14, anticorps CSTN3, anticorps Cs3, anticorps Cst-3, anticorps mKIAA0726, anticorps Cstn3, anticorps calsyntenin 3, anticorps calsyntenin 3 S homeolog, anticorps CLSTN3, anticorps clstn3.S, anticorps Clstn3

Sujet: CLSTN3 may modulate calcium-mediated postsynaptic signals. Complex formation with APBA2 and APP,CLSTN3 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.

Poids moléculaire: 106 kDa (MW of target protein)