DLG2 anticorps
-
- Antigène Voir toutes DLG2 Anticorps
- DLG2 (Discs, Large Homolog 2 (DLG2))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DLG2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DLG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS
- Top Product
- Discover our top product DLG2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DLG2 Blocking Peptide, catalog no. 33R-5991, is also available for use as a blocking control in assays to test for specificity of this DLG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DLG2 (Discs, Large Homolog 2 (DLG2))
- Autre désignation
- DLG2 (DLG2 Produits)
- Synonymes
- anticorps PPP1R58, anticorps PSD-93, anticorps PSD93, anticorps chapsyn-110, anticorps A330103J02Rik, anticorps B230218P12Rik, anticorps B330007M19Rik, anticorps Dlgh2, anticorps Gm1197, anticorps discs, large homolog 2 (Drosophila), anticorps discs large MAGUK scaffold protein 2, anticorps dlg2, anticorps DLG2, anticorps Dlg2
- Sujet
- DLG2 is a member of the membrane-associated guanylate kinase (MAGUK) family. The protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins.
- Poids moléculaire
- 97 kDa (MW of target protein)
-