MPZL1 anticorps (Middle Region)
-
- Antigène Voir toutes MPZL1 Anticorps
- MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MPZL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MPZL1 antibody was raised against the middle region of MPZL1
- Purification
- Affinity purified
- Immunogène
- MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE
- Top Product
- Discover our top product MPZL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MPZL1 Blocking Peptide, catalog no. 33R-4168, is also available for use as a blocking control in assays to test for specificity of this MPZL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))
- Autre désignation
- MPZL1 (MPZL1 Produits)
- Synonymes
- anticorps MPZL1, anticorps MPZL1b, anticorps PZR, anticorps PZR1b, anticorps PZRa, anticorps PZRb, anticorps 1110007A10Rik, anticorps myelin protein zero like 1, anticorps myelin protein zero-like 1, anticorps MPZL1, anticorps Mpzl1
- Sujet
- MPZL1 is a cell surface receptor, which is involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2.
- Poids moléculaire
- 23 kDa (MW of target protein)
-