HERPUD2 anticorps (N-Term)

N° du produit ABIN635204

Détail du produit anti-HERPUD2 anticorps

Antigène: HERPUD2 (HERPUD Family Member 2 (HERPUD2))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HERPUD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: HERPUD2 antibody was raised against the N terminal of HERPUD2

Purification: Affinity purified

Immunogène: HERPUD2 antibody was raised using the N terminal of HERPUD2 corresponding to a region with amino acids MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HERPUD2 Blocking Peptide, catalog no. 33R-5864, is also available for use as a blocking control in assays to test for specificity of this HERPUD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERPUD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HERPUD2

Antigène: HERPUD2 (HERPUD Family Member 2 (HERPUD2))

Autre désignation: HERPUD2 (HERPUD2 Produits)

Synonymes: anticorps zgc:56020, anticorps zgc:76968, anticorps 5031400M07Rik, anticorps AB041580, anticorps RGD1307343, anticorps HERPUD family member 2, anticorps HERPUD family member 2 L homeolog, anticorps herpud2, anticorps HERPUD2, anticorps Herpud2, anticorps herpud2.L

Sujet: HERPUD2 could be involved in the unfolded protein response (UPR) pathway.

Poids moléculaire: 45 kDa (MW of target protein)