TRAF3IP3 anticorps (Middle Region)
-
- Antigène Voir toutes TRAF3IP3 Anticorps
- TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRAF3IP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRAF3 IP3 antibody was raised against the middle region of TRAF3 P3
- Purification
- Affinity purified
- Immunogène
- TRAF3 IP3 antibody was raised using the middle region of TRAF3 P3 corresponding to a region with amino acids KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS
- Top Product
- Discover our top product TRAF3IP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRAF3IP3 Blocking Peptide, catalog no. 33R-4606, is also available for use as a blocking control in assays to test for specificity of this TRAF3IP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF0 P3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))
- Autre désignation
- TRAF3IP3 (TRAF3IP3 Produits)
- Synonymes
- anticorps DJ434O14.3, anticorps T3JAM, anticorps 6030423D04Rik, anticorps AI115021, anticorps T3jam, anticorps RGD1304848, anticorps TRAF3 interacting protein 3, anticorps TRAF3IP3, anticorps Traf3ip3
- Sujet
- TRAF3IP3 stimulated cell growth by modulating the c-Jun N-terminal kinase (JNK) pathway. TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.
- Poids moléculaire
- 61 kDa (MW of target protein)
-