MPG anticorps (C-Term)

N° du produit ABIN635211

Détail du produit anti-MPG anticorps

Antigène: MPG (N-Methylpurine-DNA Glycosylase (MPG))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPG est non-conjugé

Application: Western Blotting (WB)

Specificité: MPG antibody was raised against the C terminal of MPG

Purification: Affinity purified

Immunogène: MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPG Blocking Peptide, catalog no. 33R-4919, is also available for use as a blocking control in assays to test for specificity of this MPG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPG

Antigène: MPG (N-Methylpurine-DNA Glycosylase (MPG))

Autre désignation: MPG (MPG Produits)

Synonymes: anticorps AAG, anticorps ADPG, anticorps APNG, anticorps CRA36.1, anticorps MDG, anticorps Mid1, anticorps PIG11, anticorps PIG16, anticorps anpg, anticorps 9830006D05, anticorps AI326268, anticorps Aag, anticorps zgc:162984, anticorps si:xx-187g17.9, anticorps MPG, anticorps MPGR, anticorps N-methylpurine DNA glycosylase, anticorps N-methylpurine-DNA glycosylase, anticorps si:xx-by187g17.9, anticorps MPG, anticorps Mpg, anticorps mpg, anticorps si:xx-by187g17.9, anticorps CpB0526, anticorps gll2491

Sujet: MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Réparation de l'ADN