FMO5 anticorps (Middle Region)
-
- Antigène Voir toutes FMO5 Anticorps
- FMO5 (Flavin Containing Monooxygenase 5 (FMO5))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FMO5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FMO5 antibody was raised against the middle region of FMO5
- Purification
- Affinity purified
- Immunogène
- FMO5 antibody was raised using the middle region of FMO5 corresponding to a region with amino acids NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN
- Top Product
- Discover our top product FMO5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FMO5 Blocking Peptide, catalog no. 33R-6751, is also available for use as a blocking control in assays to test for specificity of this FMO5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FMO5 (Flavin Containing Monooxygenase 5 (FMO5))
- Autre désignation
- FMO5 (FMO5 Produits)
- Synonymes
- anticorps MGC68633, anticorps MGC108355, anticorps sb:cb1007, anticorps wu:fc05b01, anticorps wu:fk47g04, anticorps 5033418D19Rik, anticorps AI195026, anticorps flavin containing monooxygenase 5 S homeolog, anticorps flavin containing monooxygenase 5, anticorps fmo5.S, anticorps fmo5, anticorps MCYG_00559, anticorps FMO5, anticorps Fmo5
- Sujet
- Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity.
- Poids moléculaire
- 59 kDa (MW of target protein)
-