LASS1 anticorps (Middle Region)

N° du produit ABIN635214

Détail du produit anti-LASS1 anticorps

Antigène: LASS1 (CERS1) (Ceramide Synthase 1 (CERS1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LASS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LASS1 antibody was raised against the middle region of LASS1

Purification: Affinity purified

Immunogène: LASS1 antibody was raised using the middle region of LASS1 corresponding to a region with amino acids LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LASS1 Blocking Peptide, catalog no. 33R-5564, is also available for use as a blocking control in assays to test for specificity of this LASS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LASS1

Antigène: LASS1 (CERS1) (Ceramide Synthase 1 (CERS1))

Autre désignation: LASS1 (CERS1 Produits)

Synonymes: anticorps LAG1, anticorps LASS1, anticorps UOG1, anticorps Lass1, anticorps Uog-1, anticorps to, anticorps LAG1 HOMOLOG 1, anticorps LONGEVITY ASSURANCE GENE 1, anticorps ceramide synthase 1, anticorps TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein, anticorps CERS1, anticorps Cers1, anticorps LAG1

Sujet: This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily.

Poids moléculaire: 39 kDa (MW of target protein)