TMEM93 anticorps (N-Term)

N° du produit ABIN635215

Détail du produit anti-TMEM93 anticorps

Antigène: TMEM93 (Transmembrane Protein 93 (TMEM93))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM93 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM93 antibody was raised against the N terminal of TMEM93

Purification: Affinity purified

Immunogène: TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM93 Blocking Peptide, catalog no. 33R-1062, is also available for use as a blocking control in assays to test for specificity of this TMEM93 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM93 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM93

Antigène: TMEM93 (Transmembrane Protein 93 (TMEM93))

Autre désignation: TMEM93 (TMEM93 Produits)

Synonymes: anticorps tmem93, anticorps wu:fb02d05, anticorps zgc:56250, anticorps zgc:77320, anticorps TMEM93, anticorps 0610009E20Rik, anticorps 0610025L18Rik, anticorps Tmem93, anticorps RGD1309231, anticorps emc6, anticorps transmembrane protein 93, anticorps ER membrane protein complex subunit 6, anticorps ER membrane protein complex subunit 6 S homeolog, anticorps CpipJ_CPIJ006367, anticorps CpipJ_CPIJ008001, anticorps Tsp_06149, anticorps EMC6, anticorps emc6, anticorps TMEM93, anticorps Emc6, anticorps emc6.S

Sujet: TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.

Poids moléculaire: 12 kDa (MW of target protein)