TCTN3 anticorps (Middle Region)
-
- Antigène Voir toutes TCTN3 Anticorps
- TCTN3 (Tectonic Family Member 3 (TCTN3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TCTN3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TCTN3 antibody was raised against the middle region of TCTN3
- Purification
- Affinity purified
- Immunogène
- TCTN3 antibody was raised using the middle region of TCTN3 corresponding to a region with amino acids LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS
- Top Product
- Discover our top product TCTN3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TCTN3 Blocking Peptide, catalog no. 33R-5493, is also available for use as a blocking control in assays to test for specificity of this TCTN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TCTN3 (Tectonic Family Member 3 (TCTN3))
- Autre désignation
- TCTN3 (TCTN3 Produits)
- Synonymes
- anticorps RGD1305166, anticorps C10orf61, anticorps JBTS18, anticorps OFD4, anticorps TECT3, anticorps 4930521E07Rik, anticorps AI197391, anticorps Tect3, anticorps tectonic family member 3, anticorps Tctn3, anticorps TCTN3
- Sujet
- TCTN3 may be involved in apoptosis regulation.
- Poids moléculaire
- 64 kDa (MW of target protein)
-