TMEM166 anticorps (N-Term)

N° du produit ABIN635222

Détail du produit anti-TMEM166 anticorps

Antigène: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM166 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM166 antibody was raised against the N terminal Of Tmem166

Purification: Affinity purified

Immunogène: TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM166 Blocking Peptide, catalog no. 33R-8044, is also available for use as a blocking control in assays to test for specificity of this TMEM166 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM166 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM166

Antigène: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Autre désignation: TMEM166 (FAM176A Produits)

Synonymes: anticorps Fam176a, anticorps RGD1559797, anticorps Tmem166, anticorps FAM176A, anticorps TMEM166, anticorps BC014699, anticorps eva-1 homolog A, regulator of programmed cell death, anticorps eva-1 homolog A (C. elegans), anticorps Eva1a, anticorps EVA1A

Sujet: TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

Poids moléculaire: 17 kDa (MW of target protein)