Fc epsilon RI/FCER1A anticorps (N-Term)

N° du produit ABIN635223

Détail du produit anti-Fc epsilon RI/FCER1A anticorps

Antigène: Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fc epsilon RI/FCER1A est non-conjugé

Application: Western Blotting (WB)

Specificité: FCER1 A antibody was raised against the N terminal of FCER1

Purification: Affinity purified

Immunogène: FCER1 A antibody was raised using the N terminal of FCER1 corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FCER1A Blocking Peptide, catalog no. ABIN5613559, is also available for use as a blocking control in assays to test for specificity of this FCER1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCER0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fc epsilon RI/FCER1A

Antigène: Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))

Autre désignation: FCER1A (FCER1A Produits)

Sujet: The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process