SLC35D3 anticorps (N-Term)

N° du produit ABIN635225

Détail du produit anti-SLC35D3 anticorps

Antigène: SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35D3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC35 D3 antibody was raised against the N terminal of SLC35 3

Purification: Affinity purified

Immunogène: SLC35 D3 antibody was raised using the N terminal of SLC35 3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35D3 Blocking Peptide, catalog no. 33R-8281, is also available for use as a blocking control in assays to test for specificity of this SLC35D3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35D3

Antigène: SLC35D3 (Solute Carrier Family 35, Member D3 (SLC35D3))

Autre désignation: SLC35D3 (SLC35D3 Produits)

Synonymes: anticorps FRCL1, anticorps bA55K22.3, anticorps 6230421J19Rik, anticorps Frcl1, anticorps solute carrier family 35, member D3, anticorps solute carrier family 35 member D3, anticorps Slc35d3, anticorps SLC35D3, anticorps slc35d3

Sujet: SLC35D3 may play a role in hemostasis as a regulator of the biosynthesis of platelet-dense granules.

Poids moléculaire: 44 kDa (MW of target protein)