ORCTL-2/SLC22A18 anticorps (N-Term)

N° du produit ABIN635226

Détail du produit anti-ORCTL-2/SLC22A18 anticorps

Antigène: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ORCTL-2/SLC22A18 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC22 A18 antibody was raised against the N terminal of SLC22 18

Purification: Affinity purified

Immunogène: SLC22 A18 antibody was raised using the N terminal of SLC22 18 corresponding to a region with amino acids AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC22A18 Blocking Peptide, catalog no. 33R-1050, is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ORCTL-2/SLC22A18

Antigène: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Autre désignation: SLC22A18 (SLC22A18 Produits)

Synonymes: anticorps MGC123168, anticorps zgc:123168, anticorps BWR1A, anticorps BWSCR1A, anticorps HET, anticorps IMPT1, anticorps ITM, anticorps ORCTL2, anticorps SLC22A1L, anticorps TSSC5, anticorps p45-BWR1A, anticorps AW260131, anticorps Impt1, anticorps Orctl2, anticorps Slc22a1l, anticorps solute carrier family 22, member 18, anticorps solute carrier family 22 member 18, anticorps solute carrier family 22 (organic cation transporter), member 18, anticorps slc22a18, anticorps SLC22A18, anticorps Slc22a18

Sujet: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney.

Poids moléculaire: 45 kDa (MW of target protein)