ANKH anticorps

N° du produit ABIN635227

Détail du produit anti-ANKH anticorps

Antigène: ANKH (Ankylosis, Progressive Homolog (Mouse) (ANKH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANKH est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ANKH antibody was raised using a synthetic peptide corresponding to a region with amino acids SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANKH Blocking Peptide, catalog no. 33R-8361, is also available for use as a blocking control in assays to test for specificity of this ANKH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANKH

Antigène: ANKH (Ankylosis, Progressive Homolog (Mouse) (ANKH))

Autre désignation: ANKH (ANKH Produits)

Synonymes: anticorps ANK, anticorps CCAL2, anticorps CMDJ, anticorps CPPDD, anticorps HANK, anticorps MANK, anticorps Ank, anticorps Ankh, anticorps D15Ertd221e, anticorps ank, anticorps mKIAA1581, anticorps ankh, anticorps wu:fc08d03, anticorps wu:fj64g09, anticorps zgc:110290, anticorps ANKH inorganic pyrophosphate transport regulator, anticorps progressive ankylosis, anticorps ANKH inorganic pyrophosphate transport regulator b, anticorps ANKH inorganic pyrophosphate transport regulator S homeolog, anticorps ANKH inorganic pyrophosphate transport regulator a, anticorps ANKH, anticorps Ankh, anticorps Ank, anticorps ankhb, anticorps ankh.S, anticorps ankha

Sujet: ANKH regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.

Poids moléculaire: 54 kDa (MW of target protein)