LRRC66 anticorps (Middle Region)
-
- Antigène Tous les produits LRRC66
- LRRC66 (Leucine Rich Repeat Containing 66 (LRRC66))
-
Épitope
- Middle Region
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRRC66 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LRRC66 antibody was raised against the middle region of LRRC66
- Purification
- Affinity purified
- Immunogène
- LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRRC66 Blocking Peptide, catalog no. 33R-6926, is also available for use as a blocking control in assays to test for specificity of this LRRC66 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC66 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRRC66 (Leucine Rich Repeat Containing 66 (LRRC66))
- Autre désignation
- LRRC66 (LRRC66 Produits)
- Synonymes
- anticorps RGD1306094, anticorps leucine rich repeat containing 66, anticorps LRRC66, anticorps Lrrc66
- Sujet
- The function of LOC339977 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 98 kDa (MW of target protein)
-