RNF170 anticorps (Middle Region)
-
- Antigène Voir toutes RNF170 Anticorps
- RNF170 (Ring Finger Protein 170 (RNF170))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF170 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNF170 antibody was raised against the middle region of RNF170
- Purification
- Affinity purified
- Immunogène
- RNF170 antibody was raised using the middle region of RNF170 corresponding to a region with amino acids CIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDY
- Top Product
- Discover our top product RNF170 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF170 Blocking Peptide, catalog no. 33R-1717, is also available for use as a blocking control in assays to test for specificity of this RNF170 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF170 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF170 (Ring Finger Protein 170 (RNF170))
- Autre désignation
- RNF170 (RNF170 Produits)
- Synonymes
- anticorps SNAX1, anticorps 6720407G21Rik, anticorps AI481227, anticorps ring finger protein 170, anticorps ring finger protein 170 L homeolog, anticorps microRNA 4469, anticorps Rnf170, anticorps RNF170, anticorps rnf170.L, anticorps MIR4469
- Sujet
- RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.
- Poids moléculaire
- 30 kDa (MW of target protein)
-