SLC41A3 anticorps (C-Term)

N° du produit ABIN635242

Détail du produit anti-SLC41A3 anticorps

Antigène: SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC41A3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC41 A3 antibody was raised against the C terminal of SLC41 3

Purification: Affinity purified

Immunogène: SLC41 A3 antibody was raised using the C terminal of SLC41 3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC41A3 Blocking Peptide, catalog no. 33R-9954, is also available for use as a blocking control in assays to test for specificity of this SLC41A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC41A3

Antigène: SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))

Autre désignation: SLC41A3 (SLC41A3 Produits)

Synonymes: anticorps slc41a1-l2, anticorps slc41a3.2, anticorps SLC41A1-L2, anticorps 1010001P06Rik, anticorps AI480742, anticorps solute carrier family 41 member 3, anticorps solute carrier family 41 member 3 L homeolog, anticorps solute carrier family 41, member 3, anticorps SLC41A3, anticorps slc41a3.L, anticorps Slc41a3

Sujet: SLC41A3 is a multi-pass membrane protein. It belongs to the SLC41A transporter family. The exact function of SLC41A3 remains unknown.

Poids moléculaire: 55 kDa (MW of target protein)