AADACL4 anticorps (N-Term)
-
- Antigène Tous les produits AADACL4
- AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AADACL4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AADACL4 antibody was raised against the N terminal of AADACL4
- Purification
- Affinity purified
- Immunogène
- AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AADACL4 Blocking Peptide, catalog no. 33R-2935, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))
- Autre désignation
- AADACL4 (AADACL4 Produits)
- Synonymes
- anticorps RGD1565761, anticorps OTTMUSG00000010747, anticorps Aadacl4, anticorps arylacetamide deacetylase like 4, anticorps arylacetamide deacetylase-like 4 S homeolog, anticorps arylacetamide deacetylase-like 4, anticorps arylacetamide deacetylase-like 4-like 3, anticorps AADACL4, anticorps aadacl4.S, anticorps aadacl4, anticorps Aadacl4, anticorps AADACL4L3, anticorps LOC100218769, anticorps LOC100713568
- Sujet
- The function of AADAC protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 46 kDa (MW of target protein)
-