USP48 anticorps (C-Term)

N° du produit ABIN635246

Détail du produit anti-USP48 anticorps

Antigène: USP48 (Ubiquitin Specific Peptidase 48 (USP48))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp USP48 est non-conjugé

Application: Western Blotting (WB)

Specificité: USP48 antibody was raised against the C terminal of USP48

Purification: Affinity purified

Immunogène: USP48 antibody was raised using the C terminal of USP48 corresponding to a region with amino acids PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

USP48 Blocking Peptide, catalog no. 33R-7311, is also available for use as a blocking control in assays to test for specificity of this USP48 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur USP48

Antigène: USP48 (Ubiquitin Specific Peptidase 48 (USP48))

Autre désignation: USP48 (USP48 Produits)

Synonymes: anticorps RAP1GA1, anticorps USP31, anticorps 2810449C13Rik, anticorps AI115503, anticorps BC021769, anticorps D330022K21Rik, anticorps Usp31, anticorps synUSP, anticorps USP48, anticorps MGC135142, anticorps zgc:112364, anticorps ubiquitin specific peptidase 48, anticorps ubiquitin specific peptidase 31, anticorps USP48, anticorps Usp48, anticorps usp48, anticorps USP31

Sujet: USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.

Poids moléculaire: 70 kDa (MW of target protein)