TMEM126B anticorps (N-Term)
-
- Antigène Tous les produits TMEM126B
- TMEM126B (Transmembrane Protein 126B (TMEM126B))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM126B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM126 B antibody was raised against the N terminal of TMEM126
- Purification
- Affinity purified
- Immunogène
- TMEM126 B antibody was raised using the N terminal of TMEM126 corresponding to a region with amino acids AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM126B Blocking Peptide, catalog no. 33R-1047, is also available for use as a blocking control in assays to test for specificity of this TMEM126B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM120 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM126B (Transmembrane Protein 126B (TMEM126B))
- Autre désignation
- TMEM126B (TMEM126B Produits)
- Synonymes
- anticorps 1110001A23Rik, anticorps RGD1308371, anticorps transmembrane protein 126B, anticorps TMEM126B, anticorps Tmem126b
- Sujet
- TMEM126B belongs to the TMEM126 family. The function remains unknown.
- Poids moléculaire
- 23 kDa (MW of target protein)
-