PIEZO2 anticorps (Middle Region)

N° du produit ABIN635249

Détail du produit anti-PIEZO2 anticorps

Antigène: PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIEZO2 est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM38 B antibody was raised against the middle region of FAM38

Purification: Affinity purified

Immunogène: FAM38 B antibody was raised using the middle region of FAM38 corresponding to a region with amino acids AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM38B Blocking Peptide, catalog no. 33R-1212, is also available for use as a blocking control in assays to test for specificity of this FAM38B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIEZO2

Antigène: PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))

Autre désignation: FAM38B (FAM38B Produits)

Synonymes: anticorps C18orf30, anticorps C18orf58, anticorps FAM38B, anticorps FAM38B2, anticorps HsT748, anticorps HsT771, anticorps 5930434P17, anticorps 9030411M15Rik, anticorps 9430028L06Rik, anticorps Fam38b, anticorps Fam38b2, anticorps RGD1306866, anticorps piezo type mechanosensitive ion channel component 2, anticorps piezo-type mechanosensitive ion channel component 2, anticorps PIEZO2, anticorps Piezo2

Sujet: The exact function of FAM38B remains unknown.

Poids moléculaire: 63 kDa (MW of target protein)