MUL1 anticorps (Middle Region)
-
- Antigène Voir toutes MUL1 Anticorps
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MUL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C1 ORF166 antibody was raised against the middle region of C1 rf166
- Purification
- Affinity purified
- Immunogène
- C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG
- Top Product
- Discover our top product MUL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C1ORF166 Blocking Peptide, catalog no. 33R-4589, is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF166 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
- Autre désignation
- C1ORF166 (MUL1 Produits)
- Synonymes
- anticorps C1orf166, anticorps GIDE, anticorps MAPL, anticorps MULAN, anticorps RNF218, anticorps RP11-401M16.2, anticorps mul1, anticorps zgc:92166, anticorps 0610009K11Rik, anticorps AV000801, anticorps Gide, anticorps RGD1309944, anticorps im:7146383, anticorps zgc:165594, anticorps mitochondrial E3 ubiquitin protein ligase 1, anticorps mitochondrial E3 ubiquitin protein ligase 1 L homeolog, anticorps mitochondrial E3 ubiquitin protein ligase 1a, anticorps mitochondrial ubiquitin ligase activator of NFKB 1, anticorps mitochondrial E3 ubiquitin protein ligase 1b, anticorps MUL1, anticorps mul1.L, anticorps mul1a, anticorps Mul1, anticorps mul1b
- Sujet
- C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-