DCST1 anticorps (C-Term)

N° du produit ABIN635257

Détail du produit anti-DCST1 anticorps

Antigène: DCST1 (DC-STAMP Domain Containing 1 (DCST1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCST1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DCST1 antibody was raised against the C terminal of DCST1

Purification: Affinity purified

Immunogène: DCST1 antibody was raised using the C terminal of DCST1 corresponding to a region with amino acids SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DCST1 Blocking Peptide, catalog no. 33R-8960, is also available for use as a blocking control in assays to test for specificity of this DCST1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCST1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCST1

Antigène: DCST1 (DC-STAMP Domain Containing 1 (DCST1))

Autre désignation: DCST1 (DCST1 Produits)

Synonymes: anticorps Dcst1, anticorps RGD1307756, anticorps A330106H01Rik, anticorps DC-STAMP domain containing 1, anticorps DCST1, anticorps dcst1, anticorps Sulku_2582, anticorps Dcst1

Sujet: The function of DCST1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 78 kDa (MW of target protein)