DCST1 anticorps (C-Term)
-
- Antigène Voir toutes DCST1 Anticorps
- DCST1 (DC-STAMP Domain Containing 1 (DCST1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DCST1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DCST1 antibody was raised against the C terminal of DCST1
- Purification
- Affinity purified
- Immunogène
- DCST1 antibody was raised using the C terminal of DCST1 corresponding to a region with amino acids SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
- Top Product
- Discover our top product DCST1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DCST1 Blocking Peptide, catalog no. 33R-8960, is also available for use as a blocking control in assays to test for specificity of this DCST1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCST1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DCST1 (DC-STAMP Domain Containing 1 (DCST1))
- Autre désignation
- DCST1 (DCST1 Produits)
- Synonymes
- anticorps Dcst1, anticorps RGD1307756, anticorps A330106H01Rik, anticorps DC-STAMP domain containing 1, anticorps DCST1, anticorps dcst1, anticorps Sulku_2582, anticorps Dcst1
- Sujet
- The function of DCST1 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 78 kDa (MW of target protein)
-